Lineage for d1si2a_ (1si2 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461881Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 461882Family b.34.14.1: PAZ domain [101691] (4 proteins)
  6. 461897Protein Eukaryotic translation initiation factor 2C 1, EIF2C1 [110165] (1 species)
  7. 461898Species Human (Homo sapiens) [TaxId:9606] [110166] (2 PDB entries)
  8. 461899Domain d1si2a_: 1si2 A: [105569]
    complex with a siRNA-like duplex

Details for d1si2a_

PDB Entry: 1si2 (more details), 2.6 Å

PDB Description: Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex of deoxynucleotide overhang

SCOP Domain Sequences for d1si2a_:

Sequence, based on SEQRES records: (download)

>d1si2a_ b.34.14.1 (A:) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens)}
maqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvt
rrpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcn
ivagqr

Sequence, based on observed residues (ATOM records): (download)

>d1si2a_ b.34.14.1 (A:) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens)}
maqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvt
rrpashqtfplqvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcnivagqr

SCOP Domain Coordinates for d1si2a_:

Click to download the PDB-style file with coordinates for d1si2a_.
(The format of our PDB-style files is described here.)

Timeline for d1si2a_: