Lineage for d1si0a_ (1si0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521176Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2521196Species Mannheimia haemolytica [TaxId:75985] [102691] (3 PDB entries)
    Uniprot Q9Z4N6
  8. 2521198Domain d1si0a_: 1si0 A: [105567]
    complexed with co3, edo, fe

Details for d1si0a_

PDB Entry: 1si0 (more details), 1.35 Å

PDB Description: Crystal Structure of Mannheimia haemolytica Ferric iron-Binding Protein A in a closed conformation
PDB Compounds: (A:) iron binding protein FbpA

SCOPe Domain Sequences for d1si0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1si0a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]}
anevnvysyrqpyliepmlknfekdtgikvniifadkglvdrvkqegelspadvlltvdi
srvmeivnadlaqkidskvleknipaqfrdsndqwfglttrarviytskdrvgklpagfd
yldlakpeykgkvcvrsgknsynvslfaamiehygiektkafleglkanlarkpqggdrd
qvkaikegicdysignsyyygkmlddekqkswaeaaiinfpsgehgthknisgvviakhs
pnkanavklieylsgekaqglyaelnheypvkegiepsaivkgwgtfksdtiklediakn
yeaalklvdevkfddf

SCOPe Domain Coordinates for d1si0a_:

Click to download the PDB-style file with coordinates for d1si0a_.
(The format of our PDB-style files is described here.)

Timeline for d1si0a_: