![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Ferric-binding protein FbpA [53867] (7 species) |
![]() | Species Mannheimia haemolytica [TaxId:75985] [102691] (3 PDB entries) Uniprot Q9Z4N6 |
![]() | Domain d1si0a_: 1si0 A: [105567] complexed with co3, edo, fe has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1si0 (more details), 1.35 Å
SCOPe Domain Sequences for d1si0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1si0a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} anevnvysyrqpyliepmlknfekdtgikvniifadkglvdrvkqegelspadvlltvdi srvmeivnadlaqkidskvleknipaqfrdsndqwfglttrarviytskdrvgklpagfd yldlakpeykgkvcvrsgknsynvslfaamiehygiektkafleglkanlarkpqggdrd qvkaikegicdysignsyyygkmlddekqkswaeaaiinfpsgehgthknisgvviakhs pnkanavklieylsgekaqglyaelnheypvkegiepsaivkgwgtfksdtiklediakn yeaalklvdevkfddf
Timeline for d1si0a_: