Lineage for d1shyb2 (1shy B:516-564)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260335Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 2260364Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 2260365Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 2260366Protein Hepatocyte growth factor receptor [111407] (1 species)
  7. 2260367Species Human (Homo sapiens) [TaxId:9606] [111408] (2 PDB entries)
    Uniprot P08581 40-564
  8. 2260368Domain d1shyb2: 1shy B:516-564 [105566]
    Other proteins in same PDB: d1shya_, d1shyb1

Details for d1shyb2

PDB Entry: 1shy (more details), 3.22 Å

PDB Description: the crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.
PDB Compounds: (B:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d1shyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shyb2 g.16.2.1 (B:516-564) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]}
nglgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqiclpa

SCOPe Domain Coordinates for d1shyb2:

Click to download the PDB-style file with coordinates for d1shyb2.
(The format of our PDB-style files is described here.)

Timeline for d1shyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1shyb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1shya_