Class g: Small proteins [56992] (91 folds) |
Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
Superfamily g.16.2: Plexin repeat [103575] (1 family) |
Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
Protein Hepatocyte growth factor receptor [111407] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111408] (2 PDB entries) Uniprot P08581 40-564 |
Domain d1shyb2: 1shy B:516-564 [105566] Other proteins in same PDB: d1shya_, d1shyb1 |
PDB Entry: 1shy (more details), 3.22 Å
SCOPe Domain Sequences for d1shyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shyb2 g.16.2.1 (B:516-564) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]} nglgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqiclpa
Timeline for d1shyb2: