SCOP 1.69: Domain d1shyb2: 1shy B:516-564

Lineage for d1shyb2 (1shy B:516-564)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.16: Trefoil/Plexin domain-like [57491] (2 superfamilies)
   disulfide-rich fold; common core is alpha+beta with two conserved disulfides

4. Superfamily g.16.2: Plexin repeat [103575] (1 family)

5. Family g.16.2.1: Plexin repeat [103576] (2 proteins)
   Pfam 01437

6. Protein Hepatocyte growth factor receptor [111407] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111408] (1 PDB entry)

8. Domain d1shyb2: 1shy B:516-564 [105566]
   Other proteins in same PDB: d1shya_, d1shyb1

Details for d1shyb2

PDB Entry: 1shy, 3.22 Å

PDB Description: the crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.

SCOP Domain Sequences for d1shyb2:

Sequence; same for both SEQRES and ATOM records:

>d1shyb2 g.16.2.1 (B:516-564) Hepatocyte growth factor receptor {Human (Homo sapiens)}
nglgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqiclpa

Timeline for d1shyb2:

• d1shyb2 is new in SCOP 1.69
  
• d1shyb2 appears in SCOP 1.71
  
• d1shyb2 appears in the current release, SCOPe 2.08