Lineage for d1shyb1 (1shy B:40-515)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469053Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 469269Superfamily b.69.12: Sema domain [101912] (1 family) (S)
    irregular 7-bladed beta-propeller with a large insertion in the fifth blade
  5. 469270Family b.69.12.1: Sema domain [101913] (3 proteins)
    Pfam 01403
  6. 469271Protein Hepatocyte growth factor receptor [110292] (1 species)
  7. 469272Species Human (Homo sapiens) [TaxId:9606] [110293] (1 PDB entry)
  8. 469273Domain d1shyb1: 1shy B:40-515 [105565]
    Other proteins in same PDB: d1shya_, d1shyb2

Details for d1shyb1

PDB Entry: 1shy (more details), 3.22 Å

PDB Description: The Crystal Structure of HGF beta-chain in Complex with the Sema Domain of the Met Receptor.

SCOP Domain Sequences for d1shyb1:

Sequence, based on SEQRES records: (download)

>d1shyb1 b.69.12.1 (B:40-515) Hepatocyte growth factor receptor {Human (Homo sapiens)}
kyqlpnftaetpiqnvilhehhiflgatnyiyvlneedlqkvaeyktgpvlehpdcfpcq
dcsskanlsggvwkdninmalvvdtyyddqliscgsvnrgtcqrhvfphnhtadiqsevh
cifspqieepsqcpdcvvsalgakvlssvkdrfinffvgntinssyfpdhplhsisvrrl
ketkdgfmfltdqsyidvlpefrdsypikyvhafesnnfiyfltvqretldaqtfhtrii
rfcsinsglhsymempleciltelvprgstkkevfnilqaayvskpgaqlarqigaslnd
dilfgvfaqskpdsaepmdrsamcafpikyvndffnkivnknnvrclqhfygpnhehcfn
rtllrnssgcearrdeyrtefttalqrvdlfmgqfsevlltsistfikgdltianlgtse
grfmqvvvsrsgpstphvnflldshpvspevivehtlnqngytlvitgkkitkipl

Sequence, based on observed residues (ATOM records): (download)

>d1shyb1 b.69.12.1 (B:40-515) Hepatocyte growth factor receptor {Human (Homo sapiens)}
kyqlpnftaetpiqnvilhehhiflgatnyiyvlneedlqkvaeyktgpvlehpdcfpcq
dcsskanlsggvwkdninmalvvdtyyddqliscgsvnrgtcqrhvfphnhtadiqsevh
cifspqieepsqcpdcvvsalgakvlssvkdrfinffvgntinssyfpdhplhsisvrrl
ketkdgfmfltdqsyidvlpefrdsypikyvhafesnnfiyfltvqretldaqtfhtrii
rfcsinsglhsymempleciltkevfnilqaayvskpgaqlarqigaslnddilfgvfaq
skpdsaepmdrsamcafpikyvndffnkinvrclqhfygpnhehcfnrdeyrtefttalq
rvdlfmgqfsevlltsistfikgdltianlgtsegrfmqvvvsrsgpstphvnflldshp
vspevivehtlnqngytlvitgkkitkipl

SCOP Domain Coordinates for d1shyb1:

Click to download the PDB-style file with coordinates for d1shyb1.
(The format of our PDB-style files is described here.)

Timeline for d1shyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1shyb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1shya_