Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Hepatocyte growth factor, HGF [110239] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110240] (2 PDB entries) Uniprot P14210 495-728 ! Uniprot P14210 495-722 |
Domain d1shya_: 1shy A: [105564] Other proteins in same PDB: d1shyb1, d1shyb2 |
PDB Entry: 1shy (more details), 3.22 Å
SCOPe Domain Sequences for d1shya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shya_ b.47.1.2 (A:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv ygwgytglinydgllrvahlyimgnekcsqhhrgkvtlneseicagaekigsgpcegdyg gplvceqhkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiilt
Timeline for d1shya_: