SCOPe 2.01: Domain d1shya_: 1shy A:

Lineage for d1shya_ (1shy A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Hepatocyte growth factor, HGF [110239] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110240] (2 PDB entries)
   Uniprot P14210 495-728 ! Uniprot P14210 495-722

8. Domain d1shya_: 1shy A: [105564]
   Other proteins in same PDB: d1shyb1, d1shyb2

Details for d1shya_

PDB Entry: 1shy, 3.22 Å

PDB Description: the crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d1shya_:

Sequence; same for both SEQRES and ATOM records:

>d1shya_ b.47.1.2 (A:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]}
vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh
grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv
ygwgytglinydgllrvahlyimgnekcsqhhrgkvtlneseicagaekigsgpcegdyg
gplvceqhkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiilt

Timeline for d1shya_:

• d1shya_ first appeared in SCOP 1.69
  
• d1shya_ appears in SCOP 1.75
  
• d1shya_ appears in SCOPe 2.02
  
• d1shya_ appears in the current release, SCOPe 2.08