Class b: All beta proteins [48724] (149 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Hepatocyte growth factor, HGF [110239] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110240] (2 PDB entries) |
Domain d1shya_: 1shy A: [105564] Other proteins in same PDB: d1shyb1, d1shyb2 mutant |
PDB Entry: 1shy (more details), 3.22 Å
SCOP Domain Sequences for d1shya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shya_ b.47.1.2 (A:) Hepatocyte growth factor, HGF {Human (Homo sapiens)} vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv ygwgytglinydgllrvahlyimgnekcsqhhrgkvtlneseicagaekigsgpcegdyg gplvceqhkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiilt
Timeline for d1shya_: