Lineage for d1shya_ (1shy A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465517Protein Hepatocyte growth factor, HGF [110239] (1 species)
  7. 465518Species Human (Homo sapiens) [TaxId:9606] [110240] (1 PDB entry)
  8. 465519Domain d1shya_: 1shy A: [105564]
    Other proteins in same PDB: d1shyb1, d1shyb2

Details for d1shya_

PDB Entry: 1shy (more details), 3.22 Å

PDB Description: the crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.

SCOP Domain Sequences for d1shya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shya_ b.47.1.2 (A:) Hepatocyte growth factor, HGF {Human (Homo sapiens)}
vvngiptrtnigwmvslryrnkhicggslikeswvltarqcfpsrdlkdyeawlgihdvh
grgdekckqvlnvsqlvygpegsdlvlmklarpavlddfvstidlpnygstipektscsv
ygwgytglinydgllrvahlyimgnekcsqhhrgkvtlneseicagaekigsgpcegdyg
gplvceqhkmrmvlgvivpgrgcaipnrpgifvrvayyakwihkiilt

SCOP Domain Coordinates for d1shya_:

Click to download the PDB-style file with coordinates for d1shya_.
(The format of our PDB-style files is described here.)

Timeline for d1shya_: