Lineage for d1shwb_ (1shw B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 458907Family b.18.1.4: Ligand-binding domain of the ephb2 receptor tyrosine kinase [49800] (1 protein)
  6. 458908Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 458909Species Mouse (Mus musculus) [TaxId:10090] [49802] (3 PDB entries)
  8. 458910Domain d1shwb_: 1shw B: [105563]
    Other proteins in same PDB: d1shwa_

Details for d1shwb_

PDB Entry: 1shw (more details), 2.2 Å

PDB Description: ephb2 / ephrina5 complex structure

SCOP Domain Sequences for d1shwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shwb_ b.18.1.4 (B:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus)}
veetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
r

SCOP Domain Coordinates for d1shwb_:

Click to download the PDB-style file with coordinates for d1shwb_.
(The format of our PDB-style files is described here.)

Timeline for d1shwb_: