Lineage for d1shwb_ (1shw B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039222Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 protein domains)
    automatically mapped to Pfam PF01404
  6. 2039227Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 2039228Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
    Uniprot P54763 27-207
  8. 2039230Domain d1shwb_: 1shw B: [105563]
    Other proteins in same PDB: d1shwa_
    complexed with zn

Details for d1shwb_

PDB Entry: 1shw (more details), 2.2 Å

PDB Description: EphB2 / EphrinA5 Complex Structure
PDB Compounds: (B:) ephrin type-b receptor 2

SCOPe Domain Sequences for d1shwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shwb_ b.18.1.4 (B:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
veetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
r

SCOPe Domain Coordinates for d1shwb_:

Click to download the PDB-style file with coordinates for d1shwb_.
(The format of our PDB-style files is described here.)

Timeline for d1shwb_: