Lineage for d1shwb_ (1shw B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
    Uniprot P54763 27-207
  8. Domain d1shwb_: 1shw B: [105563]
    Other proteins in same PDB: d1shwa_
    complexed with zn

Details for d1shwb_

PDB Entry: 1shw (more details), 2.2 Å

PDB Description: ephb2 / ephrina5 complex structure
PDB Compounds: (B:) ephrin type-b receptor 2

SCOPe Domain Sequences for d1shwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shwb_ b.18.1.4 (B:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
veetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
r

SCOPe Domain Coordinates for d1shwb_ are not available.

Timeline for d1shwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1shwa_