SCOP 1.75: Domain d1shqb_: 1shq B:

Lineage for d1shqb_ (1shq B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (5 families)

5. Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
   common fold is decorated with several large insertions

6. Protein Alkaline phosphatase [53651] (3 species)

7. Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries)
   Uniprot Q9BHT8 # fragment

8. Domain d1shqb_: 1shq B: [105561]
   complexed with mg, nag, so4, zn

Details for d1shqb_

PDB Entry: 1shq, 2 Å

PDB Description: crystal structure of shrimp alkaline phosphatase with magnesium in m3

PDB Compounds: (B:) alkaline phosphatase

SCOP Domain Sequences for d1shqb_:

Sequence; same for both SEQRES and ATOM records:

>d1shqb_ c.76.1.1 (B:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]}
eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

Timeline for d1shqb_:

• d1shqb_ first appeared in SCOP 1.69
  
• d1shqb_ appears in SCOP 1.73
  
• d1shqb_ appears in SCOPe 2.01
  
• d1shqb_ appears in the current release, SCOPe 2.08, called d1shqb1