Lineage for d1shqb_ (1shq B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 492901Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 492902Superfamily c.76.1: Alkaline phosphatase-like [53649] (4 families) (S)
  5. 492903Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
    common fold is decorated with several large insertions
  6. 492904Protein Alkaline phosphatase [53651] (3 species)
  7. 492970Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries)
  8. 492976Domain d1shqb_: 1shq B: [105561]

Details for d1shqb_

PDB Entry: 1shq (more details), 2 Å

PDB Description: crystal structure of shrimp alkaline phosphatase with magnesium in m3

SCOP Domain Sequences for d1shqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shqb_ c.76.1.1 (B:) Alkaline phosphatase {Northern shrimp (Pandalus borealis)}
eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

SCOP Domain Coordinates for d1shqb_:

Click to download the PDB-style file with coordinates for d1shqb_.
(The format of our PDB-style files is described here.)

Timeline for d1shqb_: