![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily) core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest |
![]() | Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) ![]() |
![]() | Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins) common fold is decorated with several large insertions automatically mapped to Pfam PF00245 |
![]() | Protein Alkaline phosphatase [53651] (4 species) |
![]() | Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries) Uniprot Q9BHT8 # fragment |
![]() | Domain d1shqb1: 1shq B:4-476 [105561] Other proteins in same PDB: d1shqa2, d1shqb2 complexed with mg, nag, so4, zn |
PDB Entry: 1shq (more details), 2 Å
SCOPe Domain Sequences for d1shqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shqb1 c.76.1.1 (B:4-476) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]} kaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfereki sweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqldesl ftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeicddi aeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasqgat asyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltkden gffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhghtlti tgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfryas aapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd
Timeline for d1shqb1: