SCOP 1.73: Domain d1shnb_: 1shn B:

Lineage for d1shnb_ (1shn B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (5 families)

5. Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
   common fold is decorated with several large insertions

6. Protein Alkaline phosphatase [53651] (3 species)

7. Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries)

8. Domain d1shnb_: 1shn B: [105559]
   complexed with nag, po4, so4, zn

Details for d1shnb_

PDB Entry: 1shn, 2.15 Å

PDB Description: crystal structure of shrimp alkaline phosphatase with phosphate bound

PDB Compounds: (B:) alkaline phosphatase

SCOP Domain Sequences for d1shnb_:

Sequence; same for both SEQRES and ATOM records:

>d1shnb_ c.76.1.1 (B:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]}
eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

Timeline for d1shnb_:

• d1shnb_ first appeared in SCOP 1.69
  
• d1shnb_ appears in SCOP 1.71
  
• d1shnb_ appears in SCOP 1.75
  
• d1shnb_ appears in the current release, SCOPe 2.08, called d1shnb1