SCOPe 2.08: Domain d1shnb1: 1shn B:4-476

Lineage for d1shnb1 (1shn B:4-476)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families)

5. Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
   common fold is decorated with several large insertions
   automatically mapped to Pfam PF00245

6. Protein Alkaline phosphatase [53651] (4 species)

7. Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries)
   Uniprot Q9BHT8 # fragment

8. Domain d1shnb1: 1shn B:4-476 [105559]
   Other proteins in same PDB: d1shna2, d1shnb2
   complexed with nag, po4, so4, zn

Details for d1shnb1

PDB Entry: 1shn, 2.15 Å

PDB Description: crystal structure of shrimp alkaline phosphatase with phosphate bound

PDB Compounds: (B:) alkaline phosphatase

SCOPe Domain Sequences for d1shnb1:

Sequence; same for both SEQRES and ATOM records:

>d1shnb1 c.76.1.1 (B:4-476) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]}
kaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfereki
sweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqldesl
ftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeicddi
aeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasqgat
asyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltkden
gffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhghtlti
tgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfryas
aapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

Timeline for d1shnb1:

• d1shnb1 first appeared in SCOP 1.69, called d1shnb_
  
• d1shnb1 appears in SCOPe 2.07