SCOPe 2.05: Domain d1shna_: 1shn A:

Lineage for d1shna_ (1shn A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families)

5. Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
   common fold is decorated with several large insertions
   automatically mapped to Pfam PF00245

6. Protein Alkaline phosphatase [53651] (4 species)

7. Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries)
   Uniprot Q9BHT8 # fragment

8. Domain d1shna_: 1shn A: [105558]
   complexed with nag, po4, so4, zn

Details for d1shna_

PDB Entry: 1shn, 2.15 Å

PDB Description: crystal structure of shrimp alkaline phosphatase with phosphate bound

PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1shna_:

Sequence; same for both SEQRES and ATOM records:

>d1shna_ c.76.1.1 (A:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]}
eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
gatasyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltk
dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
yasaapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

Timeline for d1shna_:

• d1shna_ first appeared in SCOP 1.69
  
• d1shna_ appears in SCOPe 2.04
  
• d1shna_ is called d1shna1 in SCOPe 2.06
  
• d1shna_ appears in the current release, SCOPe 2.08, called d1shna1