Lineage for d1shla_ (1shl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854798Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2854799Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2854800Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)
  6. 2854851Protein Caspase-7 [63961] (1 species)
  7. 2854852Species Human (Homo sapiens) [TaxId:9606] [63962] (12 PDB entries)
    Uniprot P55210 57-303
  8. 2854875Domain d1shla_: 1shl A: [105556]
    complexed with fxn

Details for d1shla_

PDB Entry: 1shl (more details), 3 Å

PDB Description: caspase-7 in complex with fica allosteric inhibitor
PDB Compounds: (A:) caspase-7

SCOPe Domain Sequences for d1shla_:

Sequence, based on SEQRES records: (download)

>d1shla_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
kpklffiqacrgteladgiqadsrykipveadflfaystvpgyyswrspgrgswfvqalc
sileehgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq

Sequence, based on observed residues (ATOM records): (download)

>d1shla_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
kpklffiqacipveadflfaystvrgswfvqalcsileehgkdleimqiltrvndrvarh
fqipcvvsmltkelyfsq

SCOPe Domain Coordinates for d1shla_:

Click to download the PDB-style file with coordinates for d1shla_.
(The format of our PDB-style files is described here.)

Timeline for d1shla_: