Lineage for d1shjb_ (1shj B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480831Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 480832Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 480833Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)
  6. 480867Protein Caspase-7 [63961] (1 species)
  7. 480868Species Human (Homo sapiens) [TaxId:9606] [63962] (9 PDB entries)
  8. 480882Domain d1shjb_: 1shj B: [105555]

Details for d1shjb_

PDB Entry: 1shj (more details), 2.8 Å

PDB Description: Caspase-7 in complex with DICA allosteric inhibitor

SCOP Domain Sequences for d1shjb_:

Sequence, based on SEQRES records: (download)

>d1shjb_ c.17.1.1 (B:) Caspase-7 {Human (Homo sapiens)}
vptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndc
scakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktl
lekpklffiqacrgtelddgiqadsgpindtdanprykipveadflfaystvpgyyswrs
pgrgswfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsm
ltkelyfsq

Sequence, based on observed residues (ATOM records): (download)

>d1shjb_ c.17.1.1 (B:) Caspase-7 {Human (Homo sapiens)}
vptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndc
scakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktl
lekpklffiqacrgprykipveadflfaystvpgswfvqalcsileehgkdleimqiltr
vndrvarhfeskqipcvvsmltkelyfsq

SCOP Domain Coordinates for d1shjb_:

Click to download the PDB-style file with coordinates for d1shjb_.
(The format of our PDB-style files is described here.)

Timeline for d1shjb_:

Domains from other chains:
(mouse over for more information)
d1shja_