SCOPe 2.07: Domain d1sh8b1: 1sh8 B:0-147

Lineage for d1sh8b1 (1sh8 B:0-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein PA5026 [110900] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110901] (1 PDB entry)
   Uniprot Q9HUE3

8. Domain d1sh8b1: 1sh8 B:0-147 [105550]
   Other proteins in same PDB: d1sh8a2, d1sh8a3, d1sh8b2
   Structural genomics target

Details for d1sh8b1

PDB Entry: 1sh8, 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA5026 from Pseudomonas aeruginosa, Probable Thioesterase

PDB Compounds: (B:) hypothetical protein PA5026

SCOPe Domain Sequences for d1sh8b1:

Sequence; same for both SEQRES and ATOM records:

>d1sh8b1 d.38.1.5 (B:0-147) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]}
hmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftla
elpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergka
eyslelqltdeqgevvaesaalyqlrsh

Timeline for d1sh8b1:

• d1sh8b1 first appeared in SCOP 1.69, called d1sh8b_
  
• d1sh8b1 appears in SCOPe 2.06
  
• d1sh8b1 appears in the current release, SCOPe 2.08