SCOP 1.69: Domain d1sh8b_: 1sh8 B:

Lineage for d1sh8b_ (1sh8 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)

6. Protein Hypothetical protein PA5026 [110900] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110901] (1 PDB entry)

8. Domain d1sh8b_: 1sh8 B: [105550]
   Structural genomics target

Details for d1sh8b_

PDB Entry: 1sh8, 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA5026 from Pseudomonas aeruginosa, Probable Thioesterase

SCOP Domain Sequences for d1sh8b_:

Sequence; same for both SEQRES and ATOM records:

>d1sh8b_ d.38.1.5 (B:) Hypothetical protein PA5026 {Pseudomonas aeruginosa}
ghmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftl
aelpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergk
aeyslelqltdeqgevvaesaalyqlrsh

Timeline for d1sh8b_:

• d1sh8b_ is new in SCOP 1.69
  
• d1sh8b_ appears in SCOP 1.71
  
• d1sh8b_ appears in the current release, SCOPe 2.08, called d1sh8b1