Lineage for d1sh8b1 (1sh8 B:0-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943880Protein Hypothetical protein PA5026 [110900] (1 species)
  7. 2943881Species Pseudomonas aeruginosa [TaxId:287] [110901] (1 PDB entry)
    Uniprot Q9HUE3
  8. 2943883Domain d1sh8b1: 1sh8 B:0-147 [105550]
    Other proteins in same PDB: d1sh8a2, d1sh8a3, d1sh8b2
    Structural genomics target

Details for d1sh8b1

PDB Entry: 1sh8 (more details), 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA5026 from Pseudomonas aeruginosa, Probable Thioesterase
PDB Compounds: (B:) hypothetical protein PA5026

SCOPe Domain Sequences for d1sh8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sh8b1 d.38.1.5 (B:0-147) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]}
hmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftla
elpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergka
eyslelqltdeqgevvaesaalyqlrsh

SCOPe Domain Coordinates for d1sh8b1:

Click to download the PDB-style file with coordinates for d1sh8b1.
(The format of our PDB-style files is described here.)

Timeline for d1sh8b1: