SCOP 1.71: Domain d1sh8a_: 1sh8 A:

Lineage for d1sh8a_ (1sh8 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)

6. Protein Hypothetical protein PA5026 [110900] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110901] (1 PDB entry)

8. Domain d1sh8a_: 1sh8 A: [105549]

Details for d1sh8a_

PDB Entry: 1sh8, 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA5026 from Pseudomonas aeruginosa, Probable Thioesterase

SCOP Domain Sequences for d1sh8a_:

Sequence; same for both SEQRES and ATOM records:

>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa}
hmplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftla
elpggalfltsfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergka
eyslelqltdeqgevvaesaalyqlrsharpgs

Timeline for d1sh8a_:

• d1sh8a_ first appeared in SCOP 1.69
  
• d1sh8a_ appears in SCOP 1.73
  
• d1sh8a_ appears in the current release, SCOPe 2.08, called d1sh8a1