SCOP 1.69: Domain d1sh6a1: 1sh6 A:8-127

Lineage for d1sh6a1 (1sh6 A:8-127)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.40: CH domain-like [47575] (2 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
   Pfam 00307

6. Protein Actin binding domain of plectin [89056] (1 species)
   duplication: consists of tandem repeat of two CH domains

7. Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)

8. Domain d1sh6a1: 1sh6 A:8-127 [105547]

Details for d1sh6a1

PDB Entry: 1sh6, 2 Å

PDB Description: Crystal structure of actin-binding domain of mouse plectin

SCOP Domain Sequences for d1sh6a1:

Sequence; same for both SEQRES and ATOM records:

>d1sh6a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens)}
erdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevlsgdslprekg
rmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvsg

Timeline for d1sh6a1:

• d1sh6a1 is new in SCOP 1.69
  
• d1sh6a1 appears in SCOP 1.71
  
• d1sh6a1 appears in the current release, SCOPe 2.08