Lineage for d1sh5b2 (1sh5 B:128-237)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443178Fold a.40: CH domain-like [47575] (2 superfamilies)
    core: 4 helices: bundle
  4. 443179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 443180Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam 00307
  6. 443181Protein Actin binding domain of plectin [89056] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 443182Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)
  8. 443186Domain d1sh5b2: 1sh5 B:128-237 [105546]

Details for d1sh5b2

PDB Entry: 1sh5 (more details), 2 Å

PDB Description: Crystal structure of actin-binding domain of mouse plectin

SCOP Domain Sequences for d1sh5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sh5b2 a.40.1.1 (B:128-237) Actin binding domain of plectin {Human (Homo sapiens)}
qsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp

SCOP Domain Coordinates for d1sh5b2:

Click to download the PDB-style file with coordinates for d1sh5b2.
(The format of our PDB-style files is described here.)

Timeline for d1sh5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sh5b1