SCOPe 2.07: Domain d1sh5b1: 1sh5 B:7-127

Lineage for d1sh5b1 (1sh5 B:7-127)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein Actin binding domain of plectin [89056] (1 species)
   duplication: consists of tandem repeat of two CH domains

7. Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)
   Uniprot Q9QXS1 182-411

8. Domain d1sh5b1: 1sh5 B:7-127 [105545]
   Other proteins in same PDB: d1sh5a3, d1sh5b3

Details for d1sh5b1

PDB Entry: 1sh5, 2 Å

PDB Description: Crystal structure of actin-binding domain of mouse plectin

PDB Compounds: (B:) Plectin 1

SCOPe Domain Sequences for d1sh5b1:

Sequence; same for both SEQRES and ATOM records:

>d1sh5b1 a.40.1.1 (B:7-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]}
derdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevlsgdslprek
grmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvs
g

Timeline for d1sh5b1:

• d1sh5b1 first appeared in SCOP 1.69
  
• d1sh5b1 appears in SCOPe 2.06
  
• d1sh5b1 appears in the current release, SCOPe 2.08