SCOPe 2.08: Domain d1sgwa1: 1sgw A:2-200

Lineage for d1sgwa1 (1sgw A:2-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Putative ABC transporter PF0895 [110560] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [110561] (1 PDB entry)
   Uniprot Q8U2E3

8. Domain d1sgwa1: 1sgw A:2-200 [105541]
   Other proteins in same PDB: d1sgwa2
   Structural genomics target
   complexed with cl, na

Details for d1sgwa1

PDB Entry: 1sgw, 1.7 Å

PDB Description: putative abc transporter (atp-binding protein) from pyrococcus furiosus pfu-867808-001

PDB Compounds: (A:) putative ABC transporter

SCOPe Domain Sequences for d1sgwa1:

Sequence; same for both SEQRES and ATOM records:

>d1sgwa1 c.37.1.12 (A:2-200) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}
kleirdlsvgydkpvleritmtiekgnvvnfhgpngigkttllktistylkplkgeiiyn
gvpitkvkgkifflpeeiivprkisvedylkavaslygvkvnkneimdalesvevldlkk
klgelsqgtirrvqlastllvnaeiyvlddpvvaidedskhkvlksileilkekgiviis
sreelsycdvnenlhkyst

Timeline for d1sgwa1:

• d1sgwa1 first appeared in SCOP 1.69, called d1sgwa_
  
• d1sgwa1 appears in SCOPe 2.07