Lineage for d1sgmb2 (1sgm B:78-188)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011781Protein Putative transcriptional regulator YxaF [109984] (1 species)
  7. 2011782Species Bacillus subtilis [TaxId:1423] [109985] (1 PDB entry)
    Uniprot P42105
  8. 2011784Domain d1sgmb2: 1sgm B:78-188 [105540]
    Other proteins in same PDB: d1sgma1, d1sgmb1

Details for d1sgmb2

PDB Entry: 1sgm (more details), 2 Å

PDB Description: crystal structure of hypothetical protein yxaf
PDB Compounds: (B:) Putative HTH-type transcriptional regulator yxaF

SCOPe Domain Sequences for d1sgmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgmb2 a.121.1.1 (B:78-188) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]}
sdpveaiqlfikktasqfdntesikgipvgllasetaliseplrtvcmkvfksweavfar
klmengfaeeeanqlgtlinsmieggimlsltnkdktpllliaeqipvlvr

SCOPe Domain Coordinates for d1sgmb2:

Click to download the PDB-style file with coordinates for d1sgmb2.
(The format of our PDB-style files is described here.)

Timeline for d1sgmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sgmb1