SCOP 1.71: Domain d1sgma2: 1sgm A:78-188

Lineage for d1sgma2 (1sgm A:78-188)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)

6. Protein Putative transcriptional regulator YxaF [109984] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [109985] (1 PDB entry)

8. Domain d1sgma2: 1sgm A:78-188 [105538]
   Other proteins in same PDB: d1sgma1, d1sgmb1

Details for d1sgma2

PDB Entry: 1sgm, 2 Å

PDB Description: crystal structure of hypothetical protein yxaf

SCOP Domain Sequences for d1sgma2:

Sequence; same for both SEQRES and ATOM records:

>d1sgma2 a.121.1.1 (A:78-188) Putative transcriptional regulator YxaF {Bacillus subtilis}
sdpveaiqlfikktasqfdntesikgipvgllasetaliseplrtvcmkvfksweavfar
klmengfaeeeanqlgtlinsmieggimlsltnkdktpllliaeqipvlvr

Timeline for d1sgma2:

• d1sgma2 first appeared in SCOP 1.69
  
• d1sgma2 appears in SCOP 1.73
  
• d1sgma2 appears in the current release, SCOPe 2.08