Lineage for d1sgma1 (1sgm A:5-77)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720837Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1721024Protein Putative transcriptional regulator YxaF [109657] (1 species)
  7. 1721025Species Bacillus subtilis [TaxId:1423] [109658] (1 PDB entry)
    Uniprot P42105
  8. 1721026Domain d1sgma1: 1sgm A:5-77 [105537]
    Other proteins in same PDB: d1sgma2, d1sgmb2

Details for d1sgma1

PDB Entry: 1sgm (more details), 2 Å

PDB Description: crystal structure of hypothetical protein yxaf
PDB Compounds: (A:) Putative HTH-type transcriptional regulator yxaF

SCOPe Domain Sequences for d1sgma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]}
gdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavtytgk
ivehliqqsmdes

SCOPe Domain Coordinates for d1sgma1:

Click to download the PDB-style file with coordinates for d1sgma1.
(The format of our PDB-style files is described here.)

Timeline for d1sgma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sgma2