![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins) |
![]() | Protein Putative transcriptional regulator YxaF [109657] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [109658] (1 PDB entry) |
![]() | Domain d1sgma1: 1sgm A:5-77 [105537] Other proteins in same PDB: d1sgma2, d1sgmb2 |
PDB Entry: 1sgm (more details), 2 Å
SCOP Domain Sequences for d1sgma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis} gdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavtytgk ivehliqqsmdes
Timeline for d1sgma1: