Lineage for d1sgla_ (1sgl A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580771Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2580772Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2580773Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 2580806Protein Trichomaglin [111145] (1 species)
  7. 2580807Species Gourd (Trichosanthes lepiniana) [TaxId:282652] [111146] (1 PDB entry)
    Uniprot P84146
  8. 2580808Domain d1sgla_: 1sgl A: [105536]
    complexed with so4

Details for d1sgla_

PDB Entry: 1sgl (more details), 2.2 Å

PDB Description: The three-dimensional structure and X-ray sequence reveal that trichomaglin is a novel S-like ribonuclease
PDB Compounds: (A:) trichomaglin

SCOPe Domain Sequences for d1sgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgla_ d.124.1.1 (A:) Trichomaglin {Gourd (Trichosanthes lepiniana) [TaxId: 282652]}
efdyfilalqwagtscrsggaccpyngcckadsptqftihglrpeysggerpscctggsf
dpdeimpffgklveywptyrcaleqscnnrkeilwgqqyekhgtcaspvikgewnyfkkt
lklfmkynvdkaledagivasnskmydlkdivvavesavgarpklrcdeeglvqklslcf
dkdfkprdcvqvgscpryvslpeipd

SCOPe Domain Coordinates for d1sgla_:

Click to download the PDB-style file with coordinates for d1sgla_.
(The format of our PDB-style files is described here.)

Timeline for d1sgla_: