![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily) alpha+beta fold |
![]() | Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) ![]() |
![]() | Family d.124.1.1: Ribonuclease Rh-like [55896] (8 proteins) |
![]() | Protein Trichomaglin [111145] (1 species) |
![]() | Species Gourd (Trichosanthes lepiniate) [111146] (1 PDB entry) |
![]() | Domain d1sgla_: 1sgl A: [105536] |
PDB Entry: 1sgl (more details), 2.2 Å
SCOP Domain Sequences for d1sgla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgla_ d.124.1.1 (A:) Trichomaglin {Gourd (Trichosanthes lepiniate)} efdyfilalqwagtscrsggaccpyngcckadsptqftihglrpeysggerpscctggsf dpdeimpffgklveywptyrcaleqscnnrkeilwgqqyekhgtcaspvikgewnyfkkt lklfmkynvdkaledagivasnskmydlkdivvavesavgarpklrcdeeglvqklslcf dkdfkprdcvqvgscpryvslpeipd
Timeline for d1sgla_: