Lineage for d1sgla_ (1sgl A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510590Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 510591Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 510592Family d.124.1.1: Ribonuclease Rh-like [55896] (8 proteins)
  6. 510624Protein Trichomaglin [111145] (1 species)
  7. 510625Species Gourd (Trichosanthes lepiniate) [111146] (1 PDB entry)
  8. 510626Domain d1sgla_: 1sgl A: [105536]

Details for d1sgla_

PDB Entry: 1sgl (more details), 2.2 Å

PDB Description: The three-dimensional structure and X-ray sequence reveal that trichomaglin is a novel S-like ribonuclease

SCOP Domain Sequences for d1sgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgla_ d.124.1.1 (A:) Trichomaglin {Gourd (Trichosanthes lepiniate)}
efdyfilalqwagtscrsggaccpyngcckadsptqftihglrpeysggerpscctggsf
dpdeimpffgklveywptyrcaleqscnnrkeilwgqqyekhgtcaspvikgewnyfkkt
lklfmkynvdkaledagivasnskmydlkdivvavesavgarpklrcdeeglvqklslcf
dkdfkprdcvqvgscpryvslpeipd

SCOP Domain Coordinates for d1sgla_:

Click to download the PDB-style file with coordinates for d1sgla_.
(The format of our PDB-style files is described here.)

Timeline for d1sgla_: