SCOP 1.69: Domain d1sgla_: 1sgl A:

Lineage for d1sgla_ (1sgl A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (8 proteins)

6. Protein Trichomaglin [111145] (1 species)

7. Species Gourd (Trichosanthes lepiniate) [111146] (1 PDB entry)

8. Domain d1sgla_: 1sgl A: [105536]

Details for d1sgla_

PDB Entry: 1sgl, 2.2 Å

PDB Description: The three-dimensional structure and X-ray sequence reveal that trichomaglin is a novel S-like ribonuclease

SCOP Domain Sequences for d1sgla_:

Sequence; same for both SEQRES and ATOM records:

>d1sgla_ d.124.1.1 (A:) Trichomaglin {Gourd (Trichosanthes lepiniate)}
efdyfilalqwagtscrsggaccpyngcckadsptqftihglrpeysggerpscctggsf
dpdeimpffgklveywptyrcaleqscnnrkeilwgqqyekhgtcaspvikgewnyfkkt
lklfmkynvdkaledagivasnskmydlkdivvavesavgarpklrcdeeglvqklslcf
dkdfkprdcvqvgscpryvslpeipd

Timeline for d1sgla_:

• d1sgla_ is new in SCOP 1.69
  
• d1sgla_ appears in SCOP 1.71
  
• d1sgla_ appears in the current release, SCOPe 2.08