SCOPe 2.07: Domain d1sgha3: 1sgh A:4-87

Lineage for d1sgha3 (1sgh A:4-87)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.4: First domain of FERM [54256] (6 proteins)

6. Protein Moesin [54257] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54258] (3 PDB entries)
   Uniprot P26038 4-297

8. Domain d1sgha3: 1sgh A:4-87 [105531]
   Other proteins in same PDB: d1sgha1, d1sgha2, d1sghb_

Details for d1sgha3

PDB Entry: 1sgh, 3.5 Å

PDB Description: Moesin FERM domain bound to EBP50 C-terminal peptide

PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d1sgha3:

Sequence; same for both SEQRES and ATOM records:

>d1sgha3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]}
tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
kvtaqdvrkespllfkfrakfype

Timeline for d1sgha3:

• d1sgha3 first appeared in SCOP 1.69
  
• d1sgha3 appears in SCOPe 2.06
  
• d1sgha3 appears in the current release, SCOPe 2.08