Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
Protein Moesin [54257] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54258] (3 PDB entries) Uniprot P26038 4-297 |
Domain d1sgha3: 1sgh A:4-87 [105531] Other proteins in same PDB: d1sgha1, d1sgha2, d1sghb_ |
PDB Entry: 1sgh (more details), 3.5 Å
SCOPe Domain Sequences for d1sgha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgha3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk kvtaqdvrkespllfkfrakfype
Timeline for d1sgha3: