SCOPe 2.01: Domain d1sgha2: 1sgh A:199-297

Lineage for d1sgha2 (1sgh A:199-297)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Moesin [50777] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50778] (3 PDB entries)
   Uniprot P26038 4-297

8. Domain d1sgha2: 1sgh A:199-297 [105530]
   Other proteins in same PDB: d1sgha1, d1sgha3, d1sghb_

Details for d1sgha2

PDB Entry: 1sgh, 3.5 Å

PDB Description: Moesin FERM domain bound to EBP50 C-terminal peptide

PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d1sgha2:

Sequence; same for both SEQRES and ATOM records:

>d1sgha2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

Timeline for d1sgha2:

• d1sgha2 first appeared in SCOP 1.69
  
• d1sgha2 appears in SCOP 1.75
  
• d1sgha2 appears in SCOPe 2.02
  
• d1sgha2 appears in the current release, SCOPe 2.08