Lineage for d1sgha2 (1sgh A:199-297)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673327Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 673349Protein Moesin [50777] (1 species)
  7. 673350Species Human (Homo sapiens) [TaxId:9606] [50778] (3 PDB entries)
  8. 673354Domain d1sgha2: 1sgh A:199-297 [105530]
    Other proteins in same PDB: d1sgha1, d1sgha3, d1sghb_

Details for d1sgha2

PDB Entry: 1sgh (more details), 3.5 Å

PDB Description: Moesin FERM domain bound to EBP50 C-terminal peptide
PDB Compounds: (A:) moesin

SCOP Domain Sequences for d1sgha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgha2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOP Domain Coordinates for d1sgha2:

Click to download the PDB-style file with coordinates for d1sgha2.
(The format of our PDB-style files is described here.)

Timeline for d1sgha2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sghb_