SCOP 1.69: Domain d1sgha2: 1sgh A:199-297

Lineage for d1sgha2 (1sgh A:199-297)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.5: Third domain of FERM [50776] (6 proteins)

6. Protein Moesin [50777] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50778] (3 PDB entries)

8. Domain d1sgha2: 1sgh A:199-297 [105530]
   Other proteins in same PDB: d1sgha1, d1sgha3, d1sghb_

Details for d1sgha2

PDB Entry: 1sgh, 3.5 Å

PDB Description: Moesin FERM domain bound to EBP50 C-terminal peptide

SCOP Domain Sequences for d1sgha2:

Sequence; same for both SEQRES and ATOM records:

>d1sgha2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens)}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

Timeline for d1sgha2:

• d1sgha2 is new in SCOP 1.69
  
• d1sgha2 appears in SCOP 1.71
  
• d1sgha2 appears in the current release, SCOPe 2.08