Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Moesin [50777] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50778] (3 PDB entries) Uniprot P26038 4-297 |
Domain d1sgha2: 1sgh A:199-297 [105530] Other proteins in same PDB: d1sgha1, d1sgha3, d1sghb_ |
PDB Entry: 1sgh (more details), 3.5 Å
SCOPe Domain Sequences for d1sgha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgha2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d1sgha2: