SCOPe 2.08: Domain d1sgha1: 1sgh A:88-198

Lineage for d1sgha1 (1sgh A:88-198)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein Moesin [47033] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47034] (3 PDB entries)
   Uniprot P26038 4-297

8. Domain d1sgha1: 1sgh A:88-198 [105529]
   Other proteins in same PDB: d1sgha2, d1sgha3, d1sghb_

Details for d1sgha1

PDB Entry: 1sgh, 3.5 Å

PDB Description: Moesin FERM domain bound to EBP50 C-terminal peptide

PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d1sgha1:

Sequence; same for both SEQRES and ATOM records:

>d1sgha1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl

Timeline for d1sgha1:

• d1sgha1 first appeared in SCOP 1.69
  
• d1sgha1 appears in SCOPe 2.07