Lineage for d1sg9b_ (1sg9 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490261Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 490262Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (39 families) (S)
  5. 490636Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (1 protein)
  6. 490637Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 490640Species Thermotoga maritima [TaxId:243274] [89745] (3 PDB entries)
  8. 490644Domain d1sg9b_: 1sg9 B: [105527]

Details for d1sg9b_

PDB Entry: 1sg9 (more details), 2.3 Å

PDB Description: crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase

SCOP Domain Sequences for d1sg9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg9b_ c.66.1.30 (B:) N5-glutamine methyltransferase, HemK {Thermotoga maritima}
sgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekril
elvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvad
igtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkek
fasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmei
gedqveelkkivsdtvflkdsagkyrflllnrrs

SCOP Domain Coordinates for d1sg9b_:

Click to download the PDB-style file with coordinates for d1sg9b_.
(The format of our PDB-style files is described here.)

Timeline for d1sg9b_: