Lineage for d1sg6a_ (1sg6 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019289Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 3019290Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 3019291Family e.22.1.1: Dehydroquinate synthase, DHQS [56797] (1 protein)
  6. 3019292Protein Dehydroquinate synthase, DHQS [56798] (2 species)
  7. 3019293Species Emericella nidulans (Aspergillus nidulans) [TaxId:162425] [56799] (10 PDB entries)
    Uniprot P07547
  8. 3019294Domain d1sg6a_: 1sg6 A: [105522]
    complexed with nad, zn

Details for d1sg6a_

PDB Entry: 1sg6 (more details), 1.7 Å

PDB Description: Crystal structure of Aspergillus nidulans 3-dehydroquinate synthase (AnDHQS) in complex with Zn2+ and NAD+, at 1.7D
PDB Compounds: (A:) Pentafunctional AROM polypeptide

SCOPe Domain Sequences for d1sg6a_:

Sequence, based on SEQRES records: (download)

>d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
ptkisilgresiiadfglwrnyvakdlisdcssttyvlvtdtnigsiytpsfeeafrkra
aeitpsprlliynrppgevsksrqtkadiedwmlsqnppcgrdtvvialgggvigdltgf
vastymrgvryvqvpttllamvdssiggktaidtplgknligaiwqptkiyidlefletl
pvrefingmaeviktaaisseeeftaleenaetilkavrrevtpgehrfegteeilkari
lasarhkayvvsaderegglrnllnwghsighaieailtpqilhgecvaigmvkeaelar
hlgilkgvavsrivkclaayglptslkdarirkltagkhcsvdqlmfnmaldkkndgpkk
kivllsaigtpyetrasvvanedirvvla

Sequence, based on observed residues (ATOM records): (download)

>d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
ptkisilgresiiadfglwrnyvakdlisdcssttyvlvtdtnigsiytpsfeeafrkra
aeitpsprlliynrppgevsksrqtkadiedwmlsqnppcgrdtvvialgggvigdltgf
vastymrgvryvqvpttllamvdssiggktaidtplgknligaiwqptkiyidlefletl
pvrefingmaeviktaaisseeeftaleenaetilkavrrevtpgehrfegteeilkari
lasarhkayvvsaglrnllnwghsighaieailtpqilhgecvaigmvkeaelarhlgil
kgvavsrivkclaayglptslkdarirkltagkhcsvdqlmfnmaldkkivllsaigtpy
etrasvvanedirvvla

SCOPe Domain Coordinates for d1sg6a_:

Click to download the PDB-style file with coordinates for d1sg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1sg6a_: