SCOPe 2.08: Domain d1sg2c1: 1sg2 C:13-153

Lineage for d1sg2c1 (1sg2 C:13-153)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.48: OmpH-like [111383] (1 superfamily)
   trimer; one subunit consists of an alpha/beta oligomerization subdomain [3-stranded parallel beta-sheet, order 213], and an antiparallel coiled coil

4. Superfamily f.48.1: OmpH-like [111384] (1 family)
   automatically mapped to Pfam PF03938

5. Family f.48.1.1: OmpH-like [111385] (1 protein)
   Pfam PF03938

6. Protein Periplasmic chaperon skp (HlpA) [111386] (1 species)

7. Species Escherichia coli [TaxId:562] [111387] (2 PDB entries)
   Uniprot P11457

8. Domain d1sg2c1: 1sg2 C:13-153 [105521]
   Other proteins in same PDB: d1sg2b2, d1sg2c2

Details for d1sg2c1

PDB Entry: 1sg2, 2.35 Å

PDB Description: crystal structure of the periplasmic chaperone skp

PDB Compounds: (C:) Seventeen Kilodalton Protein

SCOPe Domain Sequences for d1sg2c1:

Sequence; same for both SEQRES and ATOM records:

>d1sg2c1 f.48.1.1 (C:13-153) Periplasmic chaperon skp (HlpA) {Escherichia coli [TaxId: 562]}
adkiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakmkklqsmkagsdr
tklekdvmaqrqtfaqkaqafeqdrarrsneergklvtriqtavksvansqdidlvvdan
avaynssdvkditadvlkqvk

Timeline for d1sg2c1:

• d1sg2c1 first appeared in SCOP 1.69, called d1sg2c_
  
• d1sg2c1 appears in SCOPe 2.07