Lineage for d1sg2a_ (1sg2 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028631Fold f.48: OmpH-like [111383] (1 superfamily)
    trimer; one subunit consists of an alpha/beta oligomerization subdomain [3-stranded parallel beta-sheet, order 213], and an antiparallel coiled coil
  4. 3028632Superfamily f.48.1: OmpH-like [111384] (1 family) (S)
    automatically mapped to Pfam PF03938
  5. 3028633Family f.48.1.1: OmpH-like [111385] (1 protein)
    Pfam PF03938
  6. 3028634Protein Periplasmic chaperon skp (HlpA) [111386] (1 species)
  7. 3028635Species Escherichia coli [TaxId:562] [111387] (2 PDB entries)
    Uniprot P11457
  8. 3028636Domain d1sg2a_: 1sg2 A: [105519]
    Other proteins in same PDB: d1sg2b2, d1sg2c2

Details for d1sg2a_

PDB Entry: 1sg2 (more details), 2.35 Å

PDB Description: crystal structure of the periplasmic chaperone skp
PDB Compounds: (A:) Seventeen Kilodalton Protein

SCOPe Domain Sequences for d1sg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg2a_ f.48.1.1 (A:) Periplasmic chaperon skp (HlpA) {Escherichia coli [TaxId: 562]}
adkiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakmkklqsmkagsdr
tklekdvmaqrqtfaqkaqafeqdrarrsneergklvtriqtavksvansqdidlvvdan
avaynssdvkditadvlkqvk

SCOPe Domain Coordinates for d1sg2a_:

Click to download the PDB-style file with coordinates for d1sg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1sg2a_: