SCOPe 2.08: Domain d1sg1x3: 1sg1 X:96-137

Lineage for d1sg1x3 (1sg1 X:96-137)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein Low affinity neurotrophin receptor p75NTR, domain 2 and domain 3 [419063] (1 species)
7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [419554] (2 PDB entries)
   Uniprot P07174 31-190 ; species # fragment contains 3 complete and 1 partial (C-terminal) 'domains'

8. Domain d1sg1x3: 1sg1 X:96-137 [105517]
   Other proteins in same PDB: d1sg1a_, d1sg1b_, d1sg1x1, d1sg1x4
   complexed with cl

Details for d1sg1x3

PDB Entry: 1sg1, 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75

PDB Compounds: (X:) Tumor necrosis factor receptor superfamily member 16

SCOPe Domain Sequences for d1sg1x3:

Sequence; same for both SEQRES and ATOM records:

>d1sg1x3 g.24.1.1 (X:96-137) Low affinity neurotrophin receptor p75NTR, domain 2 and domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acsvcevgsglvfscqdkqntvceecpegtysdeanhvdpcl

Timeline for d1sg1x3:

• d1sg1x3 first appeared in SCOP 1.69
  
• d1sg1x3 appears in SCOPe 2.07