![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (2 families) ![]() |
![]() | Family g.24.1.1: TNF receptor-like [57587] (5 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
![]() | Protein Low affinity neurotrophin receptor p75NTR [111413] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [111414] (1 PDB entry) |
![]() | Domain d1sg1x1: 1sg1 X:2-56 [105515] Other proteins in same PDB: d1sg1a_, d1sg1b_ |
PDB Entry: 1sg1 (more details), 2.4 Å
SCOP Domain Sequences for d1sg1x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sg1x1 g.24.1.1 (X:2-56) Low affinity neurotrophin receptor p75NTR {Rat (Rattus norvegicus) [TaxId: 10116]} etcstglythsgecckacnlgegvaqpcganqtvcepcldnvtfsdvvsatepck
Timeline for d1sg1x1: