SCOP 1.75: Domain d1sg1a_: 1sg1 A:

Lineage for d1sg1a_ (1sg1 A:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.3: Neurotrophin [57520] (4 proteins)

6. Protein beta-Nerve growth factor [57525] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57527] (3 PDB entries)
   Uniprot P01138

8. Domain d1sg1a_: 1sg1 A: [105513]
   Other proteins in same PDB: d1sg1x1, d1sg1x2, d1sg1x3, d1sg1x4

Details for d1sg1a_

PDB Entry: 1sg1, 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75

PDB Compounds: (A:) Beta-nerve growth factor

SCOP Domain Sequences for d1sg1a_:

Sequence, based on SEQRES records:

>d1sg1a_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
efsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsgcrg
idskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records):

>d1sg1a_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
efsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidskhw
nsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Timeline for d1sg1a_:

• d1sg1a_ first appeared in SCOP 1.69
  
• d1sg1a_ appears in SCOP 1.73
  
• d1sg1a_ appears in SCOPe 2.01
  
• d1sg1a_ appears in the current release, SCOPe 2.08