Lineage for d1sg1a_ (1sg1 A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522937Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 522938Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 523036Family g.17.1.3: Neurotrophin [57520] (4 proteins)
  6. 523037Protein beta-Nerve growth factor [57525] (2 species)
  7. 523038Species Human (Homo sapiens) [TaxId:9606] [57527] (2 PDB entries)
  8. 523041Domain d1sg1a_: 1sg1 A: [105513]
    Other proteins in same PDB: d1sg1x1, d1sg1x2, d1sg1x3, d1sg1x4

Details for d1sg1a_

PDB Entry: 1sg1 (more details), 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75

SCOP Domain Sequences for d1sg1a_:

Sequence, based on SEQRES records: (download)

>d1sg1a_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens)}
efsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsgcrg
idskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records): (download)

>d1sg1a_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens)}
efsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidskhw
nsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

SCOP Domain Coordinates for d1sg1a_:

Click to download the PDB-style file with coordinates for d1sg1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sg1a_: