Lineage for d1sg1a_ (1sg1 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033808Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 3033809Protein beta-Nerve growth factor [57525] (2 species)
  7. 3033810Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries)
    Uniprot P01138
  8. 3033813Domain d1sg1a_: 1sg1 A: [105513]
    Other proteins in same PDB: d1sg1x1, d1sg1x2, d1sg1x3, d1sg1x4
    complexed with cl

Details for d1sg1a_

PDB Entry: 1sg1 (more details), 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75
PDB Compounds: (A:) Beta-nerve growth factor

SCOPe Domain Sequences for d1sg1a_:

Sequence, based on SEQRES records: (download)

>d1sg1a_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
efsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsgcrg
idskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records): (download)

>d1sg1a_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
efsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidskhw
nsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

SCOPe Domain Coordinates for d1sg1a_:

Click to download the PDB-style file with coordinates for d1sg1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sg1a_: