SCOPe 2.05: Domain d1sfyf_: 1sfy F:

Lineage for d1sfyf_ (1sfy F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
   Uniprot P16404

8. Domain d1sfyf_: 1sfy F: [105512]
   complexed with ca, lat, mn

Details for d1sfyf_

PDB Entry: 1sfy, 2.55 Å

PDB Description: crystal structure of recombinant erythrina corallodandron lectin

PDB Compounds: (F:) lectin

SCOPe Domain Sequences for d1sfyf_:

Sequence; same for both SEQRES and ATOM records:

>d1sfyf_ b.29.1.1 (F:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]}
vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

Timeline for d1sfyf_:

• d1sfyf_ first appeared in SCOP 1.69
  
• d1sfyf_ appears in SCOPe 2.04
  
• d1sfyf_ appears in SCOPe 2.06
  
• d1sfyf_ appears in the current release, SCOPe 2.08